Name | GALC antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7164 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
Purity/Format | Affinity purified |
Blocking Peptide | GALC Blocking Peptide |
Description | Rabbit polyclonal GALC antibody raised against the middle region of GALC |
Gene | GALC |
Supplier Page | Shop |