| Name | GALC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7164 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | GALC Blocking Peptide |
| Description | Rabbit polyclonal GALC antibody raised against the middle region of GALC |
| Gene | GALC |
| Supplier Page | Shop |