| Name | IFI6 Recombinant Protein (OPCA02687) |
|---|---|
| Supplier | Aviva Systems Biology |
| Catalog | OPCA02687 |
| Category | Protein |
| Prices | $250.00 |
| Sizes | 50 µg |
| Nature | Recombinant |
| Source | Human |
| Tag/Conjugation | His-tag |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| SwissProt/Accession | P09912 |
| Gene | IFI6 |
| Sequence | GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE |
| Description | This gene was first identified as one of the many genes induced by interferon |
| Supplier Page | Shop |