Human SCGB1D1 full length protein
| Name | Human SCGB1D1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab175467 |
| Category | Protein |
| Applications | ELISA WB MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 95 % Densitometry. ab175467 is purifed using Ni-NTA chromatography. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O95968 |
| Gene | SCGB1D1 |
| Residue | 22 to 90 |
| Sequence | VVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKMEVKKCVDTMAY EKRVLITKTLGKIAEKCDR |
| Supplier Page | Shop |
Product images
14% SDS-PAGE analysis of ab175467 Lane 1: reduced and boiled sample (2.5 μg) Lane 2: non-reduced and non-boiled sample (2.5 μg)