Active mouse IGF1 protein fragment

Name	Active mouse IGF1 protein fragment
Supplier	Abcam
Catalog	ab9861
Category	Protein
Prices	$110.00, $257.00
Sizes	10 µg, 50 µg
Applications	FA SDS-PAGE
Species Reactivities	Mouse
Nature	Recombinant
Source	E. coli
Bioactivity	active
Endotoxin	< 0.100 Eu/µg
SwissProt/Accession	P05019
Gene	IGF1
Residue	49 to 118
Sequence	GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPTKAA
Supplier Page	Shop

Product References

Investigation of sequential growth factor delivery during cuprizone challenge in - Investigation of sequential growth factor delivery during cuprizone challenge in

Sabo JK, Aumann TD, Kilpatrick TJ, Cate HS. PLoS One. 2013 May 1;8(5):e63415.

Matrix IGF-1 maintains bone mass by activation of mTOR in mesenchymal stem cells. - Matrix IGF-1 maintains bone mass by activation of mTOR in mesenchymal stem cells.

Xian L, Wu X, Pang L, Lou M, Rosen CJ, Qiu T, Crane J, Frassica F, Zhang L, Rodriguez JP, Xiaofeng Jia, Shoshana Yakar, Shouhong Xuan, Argiris Efstratiadis, Mei Wan, Xu Cao. Nat Med. 2012 Jul;18(7):1095-101.

Down-regulation of manganese-superoxide dismutase through phosphorylation of - Down-regulation of manganese-superoxide dismutase through phosphorylation of

Li M, Chiu JF, Mossman BT, Fukagawa NK. J Biol Chem. 2006 Dec 29;281(52):40429-39. Epub 2006 Nov 1.