MMS2 protein

Name MMS2 protein
Supplier Abcam
Catalog ab127398
Category Protein
Applications HPLC
Species Reactivities Yeast
Nature Recombinant
Source Saccharomyces cerevisiae
Tag/Conjugation Unconjugated
SwissProt/Accession P53152
Gene MMS2
Sequence MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPH SNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTL RDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF
Supplier Page Shop

Product References

Mms2-Ubc13 covalently bound to ubiquitin reveals the structural basis of - Mms2-Ubc13 covalently bound to ubiquitin reveals the structural basis of

Eddins MJ, Carlile CM, Gomez KM, Pickart CM, Wolberger C. Nat Struct Mol Biol. 2006 Oct;13(10):915-20. Epub 2006 Sep 17.

Molecular insights into polyubiquitin chain assembly: crystal structure of the - Molecular insights into polyubiquitin chain assembly: crystal structure of the

VanDemark AP, Hofmann RM, Tsui C, Pickart CM, Wolberger C. Cell. 2001 Jun 15;105(6):711-20.

Crystal structure of the human ubiquitin conjugating enzyme complex, - Crystal structure of the human ubiquitin conjugating enzyme complex,

Moraes TF, Edwards RA, McKenna S, Pastushok L, Xiao W, Glover JN, Ellison MJ. Nat Struct Biol. 2001 Aug;8(8):669-73.

Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of - Noncanonical MMS2-encoded ubiquitin-conjugating enzyme functions in assembly of

Hofmann RM, Pickart CM. Cell. 1999 Mar 5;96(5):645-53.