| Name | Recombinant Human CHRNA5 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CHRNA5-30389TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P30532 |
| Gene | CHRNA5 |
| Sequence | SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP |
| Description | Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 5 with a N terminal proprietary tag: predicted molecular weight 35.97 kDa inclusive of tag. |
| Supplier Page | Shop |