| Name | Recombinant Swine IL-6 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | IL6-29S |
| Category | Protein |
| Species Reactivities | Pig |
| Nature | Recombinant |
| Source | Yeast |
| Bioactivity | The biological activity of recombinant swine IL-6 was measured in a cell proliferation assay using the mouse B9 cell line. The ED50 for this effect is typically 1-10 pg/mL. |
| Gene | IL6 |
| Sequence | GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183) |
| Description | Swine IL-6 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified. |
| Supplier Page | Shop |