Name | Recombinant Human Pin1 Protein |
---|---|
Supplier | Novus Biologicals |
Catalog | NBC1-18415 |
Category | Protein |
Prices | $269.00 |
Sizes | 100 µg |
Applications | FA SDS-PAGE |
Species Reactivities | Human |
Nature | Recombinant |
Purity | >95% pure by SDS-PAGE |
Bioactivity | Specific activity is > 1,200 nmoles/min/mg, and is defined as the amount of enzyme that cleaves of suc-AAFP-pNA per minute at 37C. |
Endotoxin | < 1.0 EU per 1 microgram of protein (determined by LAL method) |
Gene | PIN1 |
Sequence | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
Description | A recombinant protein corresponding to PIN1 |
Supplier Page | Shop |