Recombinant Human Pin1 Protein

Name Recombinant Human Pin1 Protein
Supplier Novus Biologicals
Catalog NBC1-18415
Category Protein
Prices $269.00
Sizes 100 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Purity >95% pure by SDS-PAGE
Bioactivity Specific activity is > 1,200 nmoles/min/mg, and is defined as the amount of enzyme that cleaves of suc-AAFP-pNA per minute at 37C.
Endotoxin < 1.0 EU per 1 microgram of protein (determined by LAL method)
Gene PIN1
Sequence MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Description A recombinant protein corresponding to PIN1
Supplier Page Shop

Product images