Home » OVOL2 » OVOL2 Proteins » OVOL2 Recombinant Protein Antigen

OVOL2 Recombinant Protein Antigen

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related OVOL2 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-88754PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

OVOL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OVOL2.

Source: E. coli

Amino Acid Sequence: QYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OVOL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88754.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OVOL2 Recombinant Protein Antigen

  • bA504H3.3
  • hOvo2
  • ovo-like 2 (Drosophila)
  • transcription factor Ovo-like 2
  • Zinc finger protein 339EUROIMAGE566589
  • ZNF339

Background

DNA-binding protein that binds to the 5'-G[GCT]GGGGG-3' core sequence. Probably acts as a transcriptionregulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

OVOL1 Antibody -
BSA Free
NBP1-89469
Immunocytochemistry/ Immunofluorescence OVOL1 Antibody - BSA Free
Immunohistochemistry-Paraffin OVOL1 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
OVOL3 Antibody -
BSA Free
NBP3-25032
Immunocytochemistry/ Immunofluorescence OVOL3 Antibody - BSA Free
Species: Hu
Applications: ICC/IF
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(48 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
GP1BB Antibody -
BSA Free
NBP1-33169
Western Blot GP1BB Antibody - BSA Free
Species: Hu, Mu
Applications: WB
Wnt-1 Antibody
(10C8)
NBP1-51575
Immunocytochemistry/ Immunofluorescence Wnt-1 Antibody (10C8)
Immunohistochemistry-Paraffin Wnt-1 Antibody (10C8)
Western Blot Wnt-1 Antibody (10C8)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
ID1 Antibody
[Unconjugated]
AF4377
Western Blot ID1 Antibody [Unconjugated]
Immunocytochemistry ID1 Antibody [Unconjugated]
Simple Western ID1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, Simple Western, WB
ALDH9A1 Antibody -
BSA Free
NBP1-89150
Western Blot ALDH9A1 Antibody - BSA Free
Western Blot ALDH9A1 Antibody - BSA Free
Immunohistochemistry-Paraffin ALDH9A1 Antibody - BSA Free
(3 Publications)
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
LEF1 Antibody
(3H5) - Azide and BSA ...
H00051176-M01
Western Blot LEF1 Antibody (3H5) - Azide and BSA Free
Sandwich ELISA LEF1 Antibody (3H5) - Azide and BSA Free
Western Blot LEF1 Antibody (3H5) - Azide and BSA Free
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(70 Publications)
Species: Mu
Applications: BA
Histone H1T
Antibody - BSA Free
NBP3-46117
Western Blot Histone H1T Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/ Immunofluorescence Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free
Western Blot Dihydrolipoamide Dehydrogenase/DLD Antibody - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
Blooms Syndrome
Protein Blm Antibody ...
NBP1-89929
Immunohistochemistry-Paraffin Blooms Syndrome Protein Blm Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Blooms Syndrome Protein Blm Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
ILT6/CD85e/LILRA3
Antibody (2E9) - Azid ...
H00011026-M01
Western Blot ILT6/CD85e/LILRA3 Antibody (2E9) - Azide and BSA Free
(6 Publications)
Species: Hu
Applications: ELISA, WB
SCP2D1
Overexpression Lysate
NBL1-08381
Western Blot SCP2D1 Overexpression Lysate
Species: Hu
Applications: WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Western Blot Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB

Publications for OVOL2 Protein (NBP1-88754PEP) (0)

There are no publications for OVOL2 Protein (NBP1-88754PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OVOL2 Protein (NBP1-88754PEP) (0)

There are no reviews for OVOL2 Protein (NBP1-88754PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OVOL2 Protein (NBP1-88754PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OVOL2 Products

Blogs on OVOL2

There are no specific blogs for OVOL2, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OVOL2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol OVOL2