Home » ATP6V0A4 » ATP6V0A4 Proteins » ATP6V0A4 Recombinant Protein Antigen

ATP6V0A4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATP6V0A4 Recombinant Protein Antigen (NBP1-89330PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

  • Loading...
Novus Biologicals offers 100% Guarantee
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

ATP6V0A4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V0A4.

Source: E. coli

Amino Acid Sequence: RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V0A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89330.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V0A4 Recombinant Protein Antigen

  • A4
  • ATP6N2
  • ATP6V0
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B
  • ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD)
  • ATPase, H+ transporting, lysosomal V0 subunit a4
  • MGC130016
  • MGC130017
  • noncatalytic accessory protein 1B
  • RDRTA2
  • RTA1C
  • RTADR
  • STV1
  • vacuolar proton pump 116 kDa accessory subunit
  • vacuolar proton pump, subunit 2
  • vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform
  • V-ATPase 116 kDa
  • VPH1
  • VPP2
  • V-type proton ATPase 116 kDa subunit a isoform 4
  • V-type proton ATPase 116 kDa subunit a

Background

The ATP6V0A4 gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ATP6V0A2 Antibody
- BSA Free
NBP1-59069
Western Blot ATP6V0A2 Antibody - BSA Free
•••
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
•••
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V0A4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP6V0A4