Home » KIF18A » KIF18A Proteins » KIF18A Recombinant Protein Antigen

KIF18A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KIF18A Protein (NBP1-85127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

  • Loading...
Novus Biologicals offers 100% Guarantee
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

KIF18A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF18A.

Source: E. coli

Amino Acid Sequence: AFQNPSTVTLMKPSSFTTSFQAISSNINSDNCLKMLCEVAIPHNRRKECGQEDLDSTFTICEDIKSSKCKLPEQESLPNDNKDILQRLDP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF18A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIF18A Recombinant Protein Antigen

  • DKFZP434G2226
  • KIF18A
  • kinesin family member 18A
  • kinesin-like protein KIF18A
  • Marrow stromal KIF18A
  • MS-KIF18A
  • OK/SW-cl.108

Background

The kinesin superfamily of proteins consists of over forty KIF motor proteins that function in intracellular transport along microtubules. Kinesin activity has been linked to various cellular functions such as vesicle transport, mitotic spindle formation, chromosome segregation, chromosome congression, and cytokinesis. Structurally, all kinesins contain a motor domain with microtubule and nucleotide binding sites that utilize ATP to target cargo along microtubule filaments. KIF18 has been demonstrated to be a microtubule depolymerase essential for chromosome alignment at the spindle equator. Alternate names for KIF18A include kinesin family member 18A, kinesin-like protein KIF18A, and DKFZP434G2226.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MCAT Antibody -
BSA Free
NBP1-83936
Immunohistochemistry-Paraffin MCAT Antibody - BSA Free
•••
Species: Hu
Applications: IHC,  IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
•••
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB

Customers Who Bought This Also Bought

Western Blot: Eg5 Antibody [NB500-181] - Human Eg5 rescues depletion of the Drosophila kinesin-5 family member Klp61F. Western blot analysis of cell lysates prepared from induced and uninduced; control and Klp61F RNAi-treated cells blotted with anti-Eg5 to monitor induction of Eg5-mCherry, anti-Klp61F to confirm depletion of the motor and anti-alpha-tubulin as a loading control. Cells depleted of Klp61F and with Eg5-mCherry induced are referred to as RepEg5 cells. Image collected and cropped by CiteAb from the following publication (https://journal.frontiersin.org/article/10.3389/fonc.2013.00187/abstract), licensed under a CC-BY license.
Eg5 Antibody - Azide and BSA Free
NB500-181

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF18A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KIF18A