Home » UNC13B » UNC13B Proteins » UNC13B Recombinant Protein Antigen

UNC13B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for UNC13B Recombinant Protein Antigen (NBP2-49364PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

  • Loading...
Novus Biologicals offers 100% Guarantee
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

UNC13B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC13B.

Source: E. coli

Amino Acid Sequence: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UNC13B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49364.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UNC13B Recombinant Protein Antigen

  • hmunc13
  • homolog of rat Munc13 (diacylglycerol-binding)
  • MGC133279
  • MGC133280
  • MUNC13
  • munc13-2
  • MUNC13B
  • protein unc-13 homolog B
  • unc-13 homolog B (C. elegans)
  • UNC13B
  • Unc13h2
  • unc-13-like (C. elegans)
  • UNC13Unc13h2

Background

The UNC13B gene is expressed in the kidney cortical epithelial cells and is upregulated by hyperglycemia. The encoded protein shares a high level of similarity to the rat homolog, and contains 3 C2 domains and a diacylglycerol-binding C1 domain. Hyperglycemia i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RIMS1 Antibody -
BSA Free
NBP3-30337
Western Blot RIMS1 Antibody - BSA Free
Species: Hu, Mu
Applications: WB
UNC13D/Munc 13-4
Antibody
NB100-41385
Western Blot UNC13D/Munc 13-4 Antibody
•••
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, PEP-ELISA, WB

Customers Who Bought This Also Bought

Western Blot: UNC13D/Munc 13-4 Antibody [NB100-41385] - A549 cells stably expressing control shRNA (Ctrl) or Munc13-4 shRNA were left untreated (Untr) or were treated with TGFbeta-1 for 24 h, and SDS-PAGE Western blotting for indicated proteins was conducted. Image collected and cropped by CiteAb from the following publication (jcb.org/lookup/doi/10.1083/jcb.201710132), licensed under a CC-BY license.
UNC13D/Munc 13-4 Antibody
NB100-41385

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UNC13B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UNC13B