ADAM22 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM22. Source: E. coli Amino Acid Sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
ADAM22 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58310. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for ADAM22 Recombinant Protein Antigen
Background
ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: AC
Publications for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)
There are no publications for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)
There are no reviews for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for ADAM22 Recombinant Protein Antigen (NBP2-58310PEP) (0)
Additional ADAM22 Products
Blogs on ADAM22