Bcl3 Recombinant Protein Antigen

Images

 
There are currently no images for Bcl3 Recombinant Protein Antigen (NBP2-57127PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research

Bcl3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl3.

Source: E. coli

Amino Acid Sequence: AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57127.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bcl3 Recombinant Protein Antigen

  • B-cell CLL/lymphoma 3
  • B-cell leukemia/lymphoma 3
  • B-cell lymphoma 3 protein
  • B-cell lymphoma 3-encoded protein
  • BCL-3
  • BCL4
  • chronic lymphatic leukemia protein
  • D19S37
  • Proto-oncogene BCL3

Background

The transcriptional coactivator, B-cell lymphoma 3-encoded protein (Bcl3) is a member of the inhibitor of nuclear factor kappaB (NF-kappaB) family. Also a known regulator of NF-kappaB, Bcl-3 plays a critical role in the development of normal immune responses. Specifically, Bcl 3 regulates transcriptional activation of NF-kappa-B target genes, by inhibiting the nuclear translocation of the NF-kappa-B p50 subunit in the cytoplasm and acting as transcriptional activator that promotes transcription of NF-kappa-B target genes in the nucleus.

Bcl-3 also contributes to the regulation of cell proliferation, and influences the survival of T cells when they are activated as a result of an immune response. It also contributes to chronic inflammatory disease states such as osteoarthritis and rheumatoid arthritis, and defects in Bcl3 may lead to B-cell chronic lymphocytic leukemia. Therefore, Bcl3 antibodies can be useful tools for studying autoimmune disease and cancer development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bcl3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL3