Home » Glucagon R/GCGR » Glucagon R/GCGR Proteins » Glucagon R/GCGR Recombinant Protein Antigen

Glucagon R/GCGR Recombinant Protein Antigen

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Glucagon R/GCGR Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55921PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glucagon R/GCGR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glucagon R/GCGR.

Source: E. coli

Amino Acid Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GCGR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55921.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glucagon R/GCGR Recombinant Protein Antigen

  • FLJ97182
  • GCGR
  • GGR
  • GLR
  • GL-R
  • Glucagon R
  • glucagon receptor
  • GlucagonR
  • MGC138246

Background

Glucagon, a pancreatic hormone, functions as an antagonist to insulin, stimulating the conversion of glycogen to glucose and increasing blood sugar levels. GLP-1 functions as a transmitter in the central nervous system, inhibiting feeding and drinking behavior. Both glucagon and GLP-1 function through their specific binding to the glucagon receptor or GLP-1R, respectively. The glucagon receptor shows expression in liver, kidney and adipose tissue. The 56 GLP-1R expression primarily localizes to areas of the hypothalamus involved in feeding behavior. Both receptors and their ligands serve as potential targets for the therapeutic treatment of diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(26 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
GLP-1R Antibody -
BSA Free
NBP1-97308
Immunocytochemistry/ Immunofluorescence GLP-1R Antibody - BSA Free
Western Blot GLP-1R Antibody - BSA Free
Western Blot GLP-1R Antibody - BSA Free
(29 Publications)
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
LXR beta/NR1H2
Antibody
NB100-74457
Western Blot LXR beta/NR1H2 Antibody
Immunocytochemistry/ Immunofluorescence LXR beta/NR1H2 Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
XPC Antibody
(3.26) - Azide and BS ...
NB100-477
Immunocytochemistry/ Immunofluorescence XPC Antibody (3.26) - Azide and BSA Free
Western Blot XPC Antibody (3.26) - Azide and BSA Free
Western Blot XPC Antibody (3.26) - Azide and BSA Free
(1 Review)
(21 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Glutathione
Reductase Antibody - ...
NBP2-16684
Western Blot Glutathione Reductase Antibody - BSA Free
Western Blot Glutathione Reductase Antibody - BSA Free
Western Blot Glutathione Reductase Antibody - BSA Free
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Species: Hu
Applications: IHC, IHC-P, WB
HOMER2 Antibody -
Azide and BSA Free
H00009455-B01P
Western Blot HOMER2 Antibody - Azide and BSA Free
Western Blot HOMER2 Antibody - Azide and BSA Free
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB
CSB Antibody - BSA
Free
NBP1-32405
Immunohistochemistry-Paraffin CSB Antibody - BSA Free
Immunohistochemistry-Paraffin CSB Antibody - BSA Free
Immunoprecipitation CSB Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Insulin Receptor
beta Antibody - BSA F ...
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody - BSA Free
Immunoprecipitation Insulin Receptor beta Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
GIP Antibody - BSA
Free
NBP1-86422
Immunohistochemistry-Paraffin GIP Antibody - BSA Free
Immunohistochemistry-Paraffin GIP Antibody - BSA Free
Immunohistochemistry-Paraffin GIP Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Secretin Antibody
- BSA Free
NBP3-41177
Immunohistochemistry-Paraffin Secretin Antibody - BSA Free
Western Blot Secretin Antibody - BSA Free
Immunohistochemistry-Paraffin Secretin Antibody - BSA Free
Species: Mu
Applications: IHC, IHC-P, WB
XPA Antibody
AF3416
Western Blot XPA Antibody
(1 Publication)
Species: Hu
Applications: WB
Glutamine
Synthetase Antibody - ...
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody - BSA Free
Western Blot Glutamine Synthetase Antibody - BSA Free
Immunohistochemistry Glutamine Synthetase Antibody - BSA Free
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)

There are no publications for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)

There are no reviews for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glucagon R/GCGR Products

Research Areas for Glucagon R/GCGR Recombinant Protein Antigen (NBP2-55921PEP)

Find related products by research area.

Blogs on Glucagon R/GCGR

There are no specific blogs for Glucagon R/GCGR, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glucagon R/GCGR Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GCGR