Recombinant Human BNIP3L

Cat.No. : BNIP3L-26756TH
Product Overview : Recombinant fragment corresponding to amino acids 43-130 of Human BNIP3L with an N terminal proprietary tag; Predicted MWt 35.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 88 amino acids
Description : This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. This protein counteracts the apoptotic inducer BNIP3 and may play a role in tumor suppression.
Molecular Weight : 35.310kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Sequence Similarities : Belongs to the NIP3 family.
Gene Name BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ]
Official Symbol BNIP3L
Synonyms BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix;
Gene ID 665
mRNA Refseq NM_004331
Protein Refseq NP_004322
MIM 605368
Uniprot ID O60238
Chromosome Location 8p21
Pathway Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem;
Function identical protein binding; lamin binding; lamin binding; protein binding; protein heterodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BNIP3L Products

Required fields are marked with *

My Review for All BNIP3L Products

Required fields are marked with *

0

Inquiry Basket

There is no product in the inquiry basket.

cartIcon