Home » HINT1 » HINT1 Proteins » Recombinant Human HINT1 Protein

Recombinant Human HINT1 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related HINT1 Peptides and Proteins

Order Details


    • Catalog Number
      H00003094-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HINT1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-68 of Human HINT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
HINT1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HINT1 Protein

  • Adenosine 5'-monophosphoramidase
  • EC 3.-
  • HINT
  • histidine triad nucleotide binding protein 1
  • histidine triad nucleotide-binding protein 1
  • histidine triad nucleotide-binding protein
  • PKCI1
  • PKCI-1FLJ30414
  • PRKCNH1FLJ32340
  • Protein kinase C inhibitor 1
  • Protein kinase C-interacting protein 1

Background

HINT1 - histidine triad nucleotide binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FHIT Antibody -
BSA Free
NBP1-89062
Western Blot FHIT Antibody - BSA Free
Immunohistochemistry-Paraffin FHIT Antibody - BSA Free
Immunohistochemistry-Paraffin FHIT Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: IHC,  IHC-P, WB
PKC iota Antibody
- BSA Free
NBP1-84959
Immunocytochemistry/ Immunofluorescence PKC iota Antibody - BSA Free
Western Blot PKC iota Antibody - BSA Free
Immunohistochemistry-Paraffin PKC iota Antibody - BSA Free
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
p27/Kip1 [p
Thr157] Antibody
AF1555
Western Blot p27/Kip1 [p Thr157] Antibody
(1 Review)
(17 Publications)
Species: Hu
Applications: WB
Cathepsin
A/Lysosomal Carboxype ...
AF1049
Immunohistochemistry Cathepsin A/Lysosomal Carboxypeptidase A Antibody
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, WB
MITF Antibody
AF5769
Western Blot MITF Antibody
Immunohistochemistry MITF Antibody
(9 Publications)
Species: Hu
Applications: IHC, WB
NDUFB6 Antibody -
BSA Free
NBP1-92172
Immunohistochemistry NDUFB6 Antibody - BSA Free
Immunohistochemistry NDUFB6 Antibody - BSA Free
Immunohistochemistry NDUFB6 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
SGPL1 Antibody
[Unconjugated]
AF5535
Western Blot SGPL1 Antibody [Unconjugated]
Simple Western SGPL1 Antibody [Unconjugated]
(15 Publications)
Species: Hu
Applications: Simple Western, WB
mu Opioid R/OPRM1
Antibody (1126B) [Unc ...
MAB8629
Immunohistochemistry mu Opioid R/OPRM1 Antibody (1126B) [Unconjugated]
(2 Publications)
Species: Rt
Applications: IHC
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Carboxylesterase
1/CES1 Antibody - BSA ...
NBP1-85691
Simple Western Carboxylesterase 1/CES1 Antibody - BSA Free
Simple Western Carboxylesterase 1/CES1 Antibody - BSA Free
Immunohistochemistry-Paraffin Carboxylesterase 1/CES1 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
RGS17 Antibody -
BSA Free
NBP1-80839
Western Blot RGS17 Antibody - BSA Free
Immunohistochemistry-Paraffin RGS17 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: IHC,  IHC-P, WB
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free
Western Blot Dihydrofolate Reductase/DHFR Antibody (2B10) - Azide and BSA Free
(12 Publications)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Aprataxin Antibody
- BSA Free
NBP2-98661
Immunocytochemistry/ Immunofluorescence Aprataxin Antibody - BSA Free
Immunohistochemistry-Paraffin Aprataxin Antibody - BSA Free
Western Blot Aprataxin Antibody - BSA Free
Species: Hu
Applications: ICC/IF,  IHC-P, WB
Cdk7 Antibody -
BSA Free
NB100-581
Western Blot Cdk7 Antibody - BSA Free
Immunoprecipitation Cdk7 Antibody - BSA Free
Western Blot Cdk7 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
CRAT Antibody -
BSA Free
NBP1-86616
Western Blot CRAT Antibody - BSA Free
Immunohistochemistry-Paraffin CRAT Antibody - BSA Free
Immunohistochemistry-Paraffin CRAT Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: IHC,  IHC-P, WB
Recombinant Human
HINT1 Protein
H00003094-Q01
Recombinant Human HINT1 Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for HINT1 Partial Recombinant Protein (H00003094-Q01) (0)

There are no publications for HINT1 Partial Recombinant Protein (H00003094-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HINT1 Partial Recombinant Protein (H00003094-Q01) (0)

There are no reviews for HINT1 Partial Recombinant Protein (H00003094-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HINT1 Partial Recombinant Protein (H00003094-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HINT1 Products

Research Areas for HINT1 Partial Recombinant Protein (H00003094-Q01)

Find related products by research area.

Blogs on HINT1

There are no specific blogs for HINT1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HINT1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol HINT1