| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 381-479 of Human UMPS partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | UMPS |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UMPS |
