Recombinant Human ABHD12B Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ABHD12B Peptides and Proteins

Order Details


    • Catalog Number
      H00145447-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ABHD12B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 255 of Human ABHD12B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ABHD12B

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ABHD12B Protein

  • abhydrolase domain containing 12B
  • abhydrolase domain-containing protein 12B
  • BEM46L3
  • c14_5314
  • C14orf29
  • chromosome 14 open reading frame 29
  • EC 3.-
  • MGC129926
  • MGC129927

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ABHD12B Recombinant Protein (H00145447-P01) (0)

There are no publications for ABHD12B Recombinant Protein (H00145447-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD12B Recombinant Protein (H00145447-P01) (0)

There are no reviews for ABHD12B Recombinant Protein (H00145447-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABHD12B Recombinant Protein (H00145447-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABHD12B Products

Blogs on ABHD12B

There are no specific blogs for ABHD12B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ABHD12B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD12B