Home » HP1 alpha » HP1 alpha Proteins » Recombinant Human HP1 alpha Protein

Recombinant Human HP1 alpha Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related HP1 alpha Peptides and Proteins

Order Details


    • Catalog Number
      H00023468-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human HP1 alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-191 of Human CBX5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
CBX5

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HP1 alpha Protein

  • Antigen p25
  • chromobox homolog 5 (Drosophila HP1 alpha)
  • chromobox homolog 5 (HP1 alpha homolog, Drosophila)
  • chromobox homolog 5
  • chromobox protein homolog 5
  • Heterochromatin protein 1 homolog alpha
  • heterochromatin protein 1-alpha
  • HP1 alpha homolog
  • HP1 alpha
  • HP1
  • HP1A
  • HP1-ALPHA
  • HP1Hs alpha
  • HP1Hs-alpha

Background

CBX5( AAH06821, 1 a.a. - 192 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3
Antibody - BSA Free
NB500-171
Immunohistochemistry-Paraffin Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Histone H3 Antibody - BSA Free
(8 Reviews)
(34 Publications)
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunofluorescence DLC1 Antibody - Isoform 1 and 3
Immunohistochemistry-Paraffin DLC1 Antibody - Isoform 1 and 3
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
KMT1A/SUV39H1
Antibody
NBP1-21367
Western Blot KMT1A/SUV39H1 Antibody
Immunohistochemistry-Paraffin KMT1A/SUV39H1 Antibody
Western Blot KMT1A/SUV39H1 Antibody
(4 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
CBX1 Antibody -
BSA Free
NBP2-98756
Immunocytochemistry/ Immunofluorescence CBX1 Antibody - BSA Free
Western Blot CBX1 Antibody - BSA Free
Immunohistochemistry-Paraffin CBX1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, IP, WB
KAP1 [p Ser824]
Antibody
NB100-2350
Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody
Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody
Immunocytochemistry/ Immunofluorescence KAP1 [p Ser824] Antibody
(1 Review)
(37 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
G9a/EHMT2 Antibody
(A8620A) [Unconjugate ...
PP-A8620A-00
Western Blot G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
Immunohistochemistry G9a/EHMT2 Antibody (A8620A) [Unconjugated]
(18 Publications)
Species: Hu, Mu
Applications: DirELISA, IHC, IP, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
CBX3 Antibody
NB100-2418
Western Blot CBX3 Antibody
Western Blot CBX3 Antibody
Immunocytochemistry/ Immunofluorescence CBX3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
HOGA1 Antibody -
BSA Free
NBP3-06562
Immunohistochemistry-Paraffin HOGA1 Antibody - BSA Free
Immunohistochemistry-Paraffin HOGA1 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
Recombinant Human
Defensin alpha 3 GST ...
H00001668-P01
SDS-PAGE Recombinant Human Defensin alpha 3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
HNF1 Antibody -
BSA Free
NBP1-33596
Western Blot HNF1 Antibody - BSA Free
Western Blot HNF1 Antibody - BSA Free
Immunoprecipitation HNF1 Antibody - BSA Free
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
SETDB1 Antibody -
BSA Free
NBP2-20322
Immunohistochemistry-Paraffin SETDB1 Antibody - BSA Free
Western Blot SETDB1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SETDB1 Antibody - BSA Free
(4 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, PLA, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(57 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for HP1 alpha Recombinant Protein (H00023468-P01) (0)

There are no publications for HP1 alpha Recombinant Protein (H00023468-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HP1 alpha Recombinant Protein (H00023468-P01) (0)

There are no reviews for HP1 alpha Recombinant Protein (H00023468-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HP1 alpha Recombinant Protein (H00023468-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HP1 alpha Products

Research Areas for HP1 alpha Recombinant Protein (H00023468-P01)

Find related products by research area.

Blogs on HP1 alpha

There are no specific blogs for HP1 alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HP1 alpha Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CBX5