Home » AG-3/AGR3 » AG-3/AGR3 Proteins » Recombinant Human AG-3/AGR3 Protein

Recombinant Human AG-3/AGR3 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related AG-3/AGR3 Peptides and Proteins

Order Details


    • Catalog Number
      H00155465-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human AG-3/AGR3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 166 of Human BCMP11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
AGR3

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AG-3/AGR3 Protein

  • AG3
  • AG-3
  • AGR3
  • anterior gradient homolog 3 (Xenopus laevis)
  • BCMP11
  • BCMP11AG3
  • Breast cancer membrane protein 11
  • hAG-3member 18
  • PDIA18

Background

AGR3 is a gene that encodes Anterior Gradient Homolog 3, a protein associated with breast cancer. Also known as Breat Cancer Membrane Protein 11, AG3 has a positive correlation with the expression of estrogen receptor. Its expression is negatively correlated with the expression of the EGF receptor. Because it is expressed in nearly three-quarters of breast cancer cells, it has high potential as a target for breast cancer therapy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AG-2/AGR2 Antibody
- BSA Free
NBP2-27393
Immunohistochemistry-Paraffin AG-2/AGR2 Antibody - BSA Free
Immunohistochemistry-Paraffin AG-2/AGR2 Antibody - BSA Free
Simple Western AG-2/AGR2 Antibody - BSA Free
(18 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NHE6/SLC9A6
Antibody - BSA Free
NBP2-38877
Immunocytochemistry/ Immunofluorescence NHE6/SLC9A6 Antibody - BSA Free
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody - BSA Free
Immunohistochemistry-Paraffin NHE6/SLC9A6 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(29 Publications)
Species: Hu
Applications: IHC, KO, WB
TXNDC12 Antibody
(9J6L2)
NBP3-33549
Immunohistochemistry TXNDC12 Antibody (9J6L2)
Immunohistochemistry TXNDC12 Antibody (9J6L2)
Immunohistochemistry TXNDC12 Antibody (9J6L2)
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
C4.4A/LYPD3
Antibody
AF5567
Western Blot C4.4A/LYPD3 Antibody
Immunohistochemistry C4.4A/LYPD3 Antibody
Immunohistochemistry C4.4A/LYPD3 Antibody
(1 Publication)
Species: Mu
Applications: IHC, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Podoplanin
Antibody [Unconjugate
AF3244
Western Blot Podoplanin Antibody [Unconjugated]
Immunohistochemistry Podoplanin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Podoplanin Antibody [Unconjugated]
(1 Review)
(79 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
EDNRB/Endothelin R
Type B Antibody - BSA ...
NLS54
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
(3 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
CHN 1 Antibody
(OTI2G6) - Azide and ...
NBP2-70411
Western Blot CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Immunohistochemistry CHN 1 Antibody (OTI2G6) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MKP-1/DUSP1
Antibody (JJ0930)
NBP2-67909
Flow Cytometry MKP-1/DUSP1 Antibody (JJ0930)
Immunohistochemistry-Paraffin MKP-1/DUSP1 Antibody (JJ0930)
Immunohistochemistry-Paraffin MKP-1/DUSP1 Antibody (JJ0930)
(5 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin POMT1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(101 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
HNF-3 alpha/FoxA1
Antibody (3B11NB) - B ...
NBP2-45269
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Western Blot HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
Flow Cytometry HNF-3 alpha/FoxA1 Antibody (3B11NB) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
Recombinant Human
AG-3/AGR3 Protein
H00155465-P01
Recombinant Human AG-3/AGR3 Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for AG-3/AGR3 Recombinant Protein (H00155465-P01) (0)

There are no publications for AG-3/AGR3 Recombinant Protein (H00155465-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AG-3/AGR3 Recombinant Protein (H00155465-P01) (0)

There are no reviews for AG-3/AGR3 Recombinant Protein (H00155465-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AG-3/AGR3 Recombinant Protein (H00155465-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AG-3/AGR3 Products

Blogs on AG-3/AGR3

There are no specific blogs for AG-3/AGR3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AG-3/AGR3 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol AGR3