Home » nfnB » nfnB Proteins » Recombinant Bacteria nfnB Protein

Recombinant Bacteria nfnB Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related nfnB Peptides and Proteins

Order Details


    • Catalog Number
      P4983
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Bacteria nfnB Protein Summary

Description
A full-length recombinant protein with His tag corresponding to the amino acids 1 - 217 of nfsB

Source: Escherichia coli

Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQPWHFIVASTEEGKARVAKSAAGNYVFNERKMLDASHVVVFCAKTAMDDVWLKLVVDQEDADGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVPIEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV
Preparation
Method
Escherichia coli expression system
Protein/Peptide Type
Recombinant Protein

Applications/Dilutions

Dilutions
  • SDS-Page
Application Notes
This product is useful for SDS-PAGE.

Reactivity Notes

Escherichia coli

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
In 20 mM Tris-HCl, 50 mM NaCl, pH 8.0 (1 mM DTT, 10% glycerol)
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Bacteria nfnB Protein

  • dprA
  • nfsB
  • nfsI
  • ntr

Background

nfnB, also known as NFSB, shows the ability to reduce quinines. nfnB is an enzyme for activating prodrugs in antibody directed enzyme prodrug therapy. nfnB is also capable of reducing nitrofurazone, quinones and the anti-tumor agent CB1954 (5-(aziridin-1-yl)-2,4-dinitrobenzamide). The reduction of CB1954 results in the generation of cytotoxic species.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for nfnB Recombinant Protein (P4983) (0)

There are no publications for nfnB Recombinant Protein (P4983).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nfnB Recombinant Protein (P4983) (0)

There are no reviews for nfnB Recombinant Protein (P4983). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for nfnB Recombinant Protein (P4983) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional nfnB Products

Array P4983

Blogs on nfnB

There are no specific blogs for nfnB, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Bacteria nfnB Protein and receive a gift card or discount.