| Name | Recombinant Human GRM8 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | GRM8-28274TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | O00222 |
| Gene | GRM8 |
| Sequence | KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII |
| Description | Recombinant fragment corresponding to amino acids 486-575 of Human Metabotropic Glutamate Receptor 8 with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
| Supplier Page | Shop |